Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Heart Shaped Labels
2 product(s) found for "Heart Shaped Labels"
Hearts - 7 Single colours Av..
Heart Shaped Labels
Hearts - 7 Single colours Av..
1,000 Printed - Heart Shape Labels - Any one colour on a White Heart - 7 colours available approx heart size 90mm x 75mm.
£49.68
Units in Stock: 17
£49.68
Details
Add To Cart
1,000 Printed - Heart Shape Labels - Any one colour on a White Heart - 7 colours available approx heart size 90mm x 75mm.
1,000 Heart Labels - Gold or..
Heart Shaped Labels
1,000 Heart Labels - Gold or..
1,000 Printed - Heart Shape Labels - Available in Lovely Shinney Foil Black on Silver, Black on Gold
£70.20
Units in Stock: 9
£70.20
Details
Add To Cart
1,000 Printed - Heart Shape Labels - Available in Lovely Shinney Foil Black on Silver, Black on Gold
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i