Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Thermal Ribbons
2 product(s) found for "Thermal Ribbons"
Thermal Ribbons 110mm x 450m
Thermal Ribbons
Thermal Ribbons 110mm x 450m
Thermal Transfer Ribbons 110mm x 450m Suitable for Zebra Machines Usually sold : 12 ribbons per box
£11.38
Units in Stock: 52
£11.38
Details
Add To Cart
Thermal Transfer Ribbons 110mm x 450m Suitable for Zebra Machines Usually sold : 12 ribbons per box
Thermal Ribbons 152mm x 450m
Thermal Ribbons
Thermal Ribbons 152mm x 450m
Thermal Transfer Ribbons 152mm x 450m Outside wound suitable for Zebra printers Usually sold 12 ribbons per box
£15.71
Units in Stock: 29
£15.71
Details
Add To Cart
Thermal Transfer Ribbons 152mm x 450m Outside wound suitable for Zebra printers Usually sold 12 ribbons per box
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i