GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT
1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT
1,000 Single Colour White 60mm Round Printed Labels - Price inc VAT
RRP £30.00
£27.00 inc. tax
£22.50 ex. tax
? Tax based on United Kingdom.
1,000 Printed  -  60mm White Labels - 7 Single colours available on white. 
£27.00 inc. tax
£22.50 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: CT0004
Product Condition: New
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i